Tag |
Content |
dbPAF ID |
dbPAF-0001622 |
Uniprot Accession |
O43715; TRIA1_HUMAN; B2R4Z7; Q5RKS5; Q6LCA7; |
Genbank Protein ID |
NP_057483.1; |
Genbank Nucleotide ID |
NM_016399.2; |
Protein Name |
TP53-regulated inhibitor of apoptosis 1 |
Protein Synonyms/Alias |
Protein 15E1.1;WF-1;p53-inducible cell-survival factor;p53CSV; |
Gene Name |
TRIAP1 |
Gene Synonyms/Alias |
15E1.1;HSPC132; |
Organism |
Homo sapiens(Human) |
NCBI Taxa ID |
9606 |
Functional Description (View all) |
Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis.Functional Description
Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis.
|
Phosphorylation Sites
|
dbPAF PTMs: 1 Position | Peptides | Source | References ( PMIDs ) |
---|
32 | EKFLKGDSSGDPCTD | curated | 25627689 |
|
Sequence (Fasta) | MNSVGEACTD MKREYDQCFN RWFAEKFLKG DSSGDPCTDL FKRYQQCVQK AIKEKEIPIE 60 GLEFMGHGKE KPENSS
77Fasta Sequence
>O43715|TRIAP1|Homo sapiens(Human) MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS
|
Keyword |
KW-0007--Acetylation KW-0053--Apoptosis KW-0181--Complete proteome KW-0963--Cytoplasm KW-0445--Lipid transport KW-0496--Mitochondrion KW-1185--Reference proteome KW-0813--Transport
|
Interpro |
IPR007918--MDM35_apoptosis
|
PROSITE |
|
Pfam |
PF05254--UPF0203
|
Gene Ontology |
GO:0005758--C:mitochondrial intermembrane space GO:0005739--C:mitochondrion GO:0048471--C:perinuclear region of cytoplasm GO:0043234--C:protein complex GO:0002039--F:p53 binding GO:0034644--P:cellular response to UV GO:0030330--P:DNA damage response, signal transduction by p53 class mediator GO:0006977--P:DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest GO:0043066--P:negative regulation of apoptotic process GO:0043154--P:negative regulation of cysteine-type endopeptidase activity involved in apoptotic process GO:1902166--P:negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator GO:0090201--P:negative regulation of release of cytochrome c from mitochondria GO:0015914--P:phospholipid transport GO:2001140--P:positive regulation of phospholipid transport GO:0045944--P:positive regulation of transcription from RNA polymerase II promoter GO:0097035--P:regulation of membrane lipid distribution
|