Tag |
Content |
dbPAF ID |
dbPAF-0000987 |
Uniprot Accession |
O15520; FGF10_HUMAN; C7FDY0; Q6FHR3; Q6FHT6; Q96P59; |
Genbank Protein ID |
NP_004456.1; XP_005248321.1; |
Genbank Nucleotide ID |
NM_004465.1; XM_005248264.2; |
Protein Name |
Fibroblast growth factor 10 |
Protein Synonyms/Alias |
|
Gene Name |
FGF10 |
Gene Synonyms/Alias |
|
Organism |
Homo sapiens(Human) |
NCBI Taxa ID |
9606 |
Functional Description (View all) |
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.Functional Description
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.
|
Phosphorylation Sites
|
dbPAF PTMs: 3 |
Sequence (Fasta) | MWKWILTHCA SAFPHLPGCC CCCFLLLFLV SSVPVTCQAL GQDMVSPEAT NSSSSSFSSP 60 SSAGRHVRSY NHLQGDVRWR KLFSFTKYFL KIEKNGKVSG TKKENCPYSI LEITSVEIGV 120 VAVKAINSNY YLAMNKKGKL YGSKEFNNDC KLKERIEENG YNTYASFNWQ HNGRQMYVAL 180 NGKGAPRRGQ KTRRKNTSAH FLPMVVHS
209Fasta Sequence
>O15520|FGF10|Homo sapiens(Human) MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
|
Keyword |
KW-0002--3D-structure KW-0181--Complete proteome KW-0225--Disease mutation KW-0038--Ectodermal dysplasia KW-0325--Glycoprotein KW-0339--Growth factor KW-0953--Lacrimo-auriculo-dento-digital syndrome KW-1185--Reference proteome KW-0964--Secreted KW-0732--Signal
|
Interpro |
IPR008996--Cytokine_IL1-like IPR028252--FGF10 IPR002209--Fibroblast_GF_fam IPR028142--IL-1_fam/FGF_fam
|
PROSITE |
PS00247--HBGF_FGF
|
Pfam |
PF00167--FGF
|
Gene Ontology |
GO:0009986--C:cell surface GO:0005576--C:extracellular region GO:0005615--C:extracellular space GO:0005634--C:nucleus GO:0005886--C:plasma membrane GO:0042056--F:chemoattractant activity GO:0005104--F:fibroblast growth factor receptor binding GO:0008083--F:growth factor activity GO:0008201--F:heparin binding GO:0005111--F:type 2 fibroblast growth factor receptor binding GO:0031532--P:actin cytoskeleton reorganization GO:0000187--P:activation of MAPK activity GO:0000186--P:activation of MAPKK activity GO:0001525--P:angiogenesis GO:0007411--P:axon guidance GO:0001974--P:blood vessel remodeling GO:0060667--P:branch elongation involved in salivary gland morphogenesis GO:0048754--P:branching morphogenesis of an epithelial tube GO:0060436--P:bronchiole morphogenesis GO:0060449--P:bud elongation involved in lung branching GO:0060447--P:bud outgrowth involved in lung branching GO:0007368--P:determination of left/right symmetry GO:0031076--P:embryonic camera-type eye development GO:0048557--P:embryonic digestive tract morphogenesis GO:0030538--P:embryonic genitalia morphogenesis GO:0009880--P:embryonic pattern specification GO:0007173--P:epidermal growth factor receptor signaling pathway GO:0010631--P:epithelial cell migration GO:0050673--P:epithelial cell proliferation GO:0060664--P:epithelial cell proliferation involved in salivary gland morphogenesis GO:0070371--P:ERK1 and ERK2 cascade GO:0000132--P:establishment of mitotic spindle orientation GO:0038095--P:Fc-epsilon receptor signaling pathway GO:0048807--P:female genitalia morphogenesis GO:0008543--P:fibroblast growth factor receptor signaling pathway GO:0060595--P:fibroblast growth factor receptor signaling pathway involved in mammary gland specification GO:0031069--P:hair follicle morphogenesis GO:0070384--P:Harderian gland development GO:0050930--P:induction of positive chemotaxis GO:0045087--P:innate immune response GO:0008286--P:insulin receptor signaling pathway GO:0043616--P:keratinocyte proliferation GO:0032808--P:lacrimal gland development GO:0060174--P:limb bud formation GO:0060428--P:lung epithelium development GO:0061115--P:lung proximal/distal axis specification GO:0060430--P:lung saccule development GO:0048808--P:male genitalia morphogenesis GO:0060615--P:mammary gland bud formation GO:0000165--P:MAPK cascade GO:0060915--P:mesenchymal cell differentiation involved in lung development GO:0060496--P:mesenchymal-epithelial cell signaling involved in lung development GO:0001823--P:mesonephros development GO:0001656--P:metanephros development GO:0003338--P:metanephros morphogenesis GO:0042693--P:muscle cell fate commitment GO:0071157--P:negative regulation of cell cycle arrest GO:0045596--P:negative regulation of cell differentiation GO:0008285--P:negative regulation of cell proliferation GO:2001240--P:negative regulation of extrinsic apoptotic signaling pathway in absence of ligand GO:0048011--P:neurotrophin TRK receptor signaling pathway GO:0042475--P:odontogenesis of dentin-containing tooth GO:0001759--P:organ induction GO:0030916--P:otic vesicle formation GO:0031016--P:pancreas development GO:0048015--P:phosphatidylinositol-mediated signaling GO:0021983--P:pituitary gland development GO:0050918--P:positive chemotaxis GO:0032781--P:positive regulation of ATPase activity GO:0090263--P:positive regulation of canonical Wnt signaling pathway GO:0031659--P:positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G1/S transition of mitotic cell cycle GO:0045739--P:positive regulation of DNA repair GO:0045740--P:positive regulation of DNA replication GO:0010634--P:positive regulation of epithelial cell migration GO:0050679--P:positive regulation of epithelial cell proliferation GO:0060054--P:positive regulation of epithelial cell proliferation involved in wound healing GO:0070374--P:positive regulation of ERK1 and ERK2 cascade GO:0048146--P:positive regulation of fibroblast proliferation GO:0071338--P:positive regulation of hair follicle cell proliferation GO:0051549--P:positive regulation of keratinocyte migration GO:0010838--P:positive regulation of keratinocyte proliferation GO:0050671--P:positive regulation of lymphocyte proliferation GO:0043410--P:positive regulation of MAPK cascade GO:0045931--P:positive regulation of mitotic cell cycle GO:0045747--P:positive regulation of Notch signaling pathway GO:0050731--P:positive regulation of peptidyl-tyrosine phosphorylation GO:0046579--P:positive regulation of Ras protein signal transduction GO:0045944--P:positive regulation of transcription from RNA polymerase II promoter GO:0045893--P:positive regulation of transcription, DNA-templated GO:0050677--P:positive regulation of urothelial cell proliferation GO:0030949--P:positive regulation of vascular endothelial growth factor receptor signaling pathway GO:0070352--P:positive regulation of white fat cell proliferation GO:0060513--P:prostatic bud formation GO:0034394--P:protein localization to cell surface GO:0060019--P:radial glial cell differentiation GO:0007265--P:Ras protein signal transduction GO:0032925--P:regulation of activin receptor signaling pathway GO:0060665--P:regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling GO:0046877--P:regulation of saliva secretion GO:0008589--P:regulation of smoothened signaling pathway GO:0032355--P:response to estradiol GO:0032496--P:response to lipopolysaccharide GO:0007431--P:salivary gland development GO:0061033--P:secretion by lung epithelial cell involved in lung growth GO:0060879--P:semicircular canal fusion GO:0007264--P:small GTPase mediated signal transduction GO:0051145--P:smooth muscle cell differentiation GO:0035019--P:somatic stem cell population maintenance GO:0048536--P:spleen development GO:0060661--P:submandibular salivary gland formation GO:0070075--P:tear secretion GO:0048538--P:thymus development GO:0030878--P:thyroid gland development GO:0042246--P:tissue regeneration GO:0060510--P:Type II pneumocyte differentiation GO:0050674--P:urothelial cell proliferation GO:0048010--P:vascular endothelial growth factor receptor signaling pathway GO:0050872--P:white fat cell differentiation GO:0042060--P:wound healing
|